Lineage for d1v0fa2 (1v0f A:761-910)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568947Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 568948Superfamily b.108.1: Phage fibre proteins [69349] (3 families) (S)
  5. 568957Family b.108.1.3: Endo-alpha-sialidase [117325] (1 protein)
  6. 568958Protein Endo-alpha-sialidase [117326] (1 species)
  7. 568959Species Bacteriophage K1F [TaxId:344021] [117327] (2 PDB entries)
  8. 568966Domain d1v0fa2: 1v0f A:761-910 [113479]
    Other proteins in same PDB: d1v0fa1, d1v0fb1, d1v0fc1, d1v0fd1, d1v0fe1, d1v0ff1

Details for d1v0fa2

PDB Entry: 1v0f (more details), 2.55 Å

PDB Description: endosialidase of bacteriophage k1f in complex with oligomeric alpha-2, 8-sialic acid

SCOP Domain Sequences for d1v0fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0fa2 b.108.1.3 (A:761-910) Endo-alpha-sialidase {Bacteriophage K1F}
srdfrygavpnravpvffdtngvrtvpapmeftgdlglghvtirastssnirsevlmege
ygfigksiptdnpagqriifcggegtssttgaqitlyganntdsrrivyngdehlfqsad
vkpyndnvtalggpsnrfttaylgsnpivt

SCOP Domain Coordinates for d1v0fa2:

Click to download the PDB-style file with coordinates for d1v0fa2.
(The format of our PDB-style files is described here.)

Timeline for d1v0fa2: