SCOPe 2.08: Domain d1v0ee2: 1v0e E:761-910

Lineage for d1v0ee2 (1v0e E:761-910)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
(homo)trimer; each chain donates 3 beta-strands per turn of the helix
Superfamily b.108.1: Phage fibre proteins [69349] (6 families)
Family b.108.1.3: Endo-alpha-sialidase [117325] (1 protein)
automatically mapped to Pfam PF12219
Protein Endo-alpha-sialidase [117326] (1 species)
Species Bacteriophage K1F [TaxId:344021] [117327] (2 PDB entries)
Uniprot Q04830 245-909
Domain d1v0ee2: 1v0e E:761-910 [113475]
Other proteins in same PDB: d1v0ea1, d1v0eb1, d1v0ec1, d1v0ed1, d1v0ee1, d1v0ef1
complexed with po4

Details for d1v0ee2

PDB Entry: 1v0e (more details), 1.9 Å

PDB Description: endosialidase of bacteriophage k1f

PDB Compounds: (E:) endo-alpha-sialidase

SCOPe Domain Sequences for d1v0ee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0ee2 b.108.1.3 (E:761-910) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]}
srdfrygavpnravpvffdtngvrtvpapmeftgdlglghvtirastssnirsevlmege
ygfigksiptdnpagqriifcggegtssttgaqitlyganntdsrrivyngdehlfqsad
vkpyndnvtalggpsnrfttaylgsnpivt

SCOPe Domain Coordinates for d1v0ee2:

Click to download the PDB-style file with coordinates for d1v0ee2.
(The format of our PDB-style files is described here.)

Timeline for d1v0ee2: