Class b: All beta proteins [48724] (178 folds) |
Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily) (homo)trimer; each chain donates 3 beta-strands per turn of the helix |
Superfamily b.108.1: Phage fibre proteins [69349] (6 families) |
Family b.108.1.3: Endo-alpha-sialidase [117325] (1 protein) automatically mapped to Pfam PF12219 |
Protein Endo-alpha-sialidase [117326] (1 species) |
Species Bacteriophage K1F [TaxId:344021] [117327] (2 PDB entries) Uniprot Q04830 245-909 |
Domain d1v0ed2: 1v0e D:761-910 [113473] Other proteins in same PDB: d1v0ea1, d1v0eb1, d1v0ec1, d1v0ed1, d1v0ee1, d1v0ef1 complexed with po4 |
PDB Entry: 1v0e (more details), 1.9 Å
SCOPe Domain Sequences for d1v0ed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v0ed2 b.108.1.3 (D:761-910) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} srdfrygavpnravpvffdtngvrtvpapmeftgdlglghvtirastssnirsevlmege ygfigksiptdnpagqriifcggegtssttgaqitlyganntdsrrivyngdehlfqsad vkpyndnvtalggpsnrfttaylgsnpivt
Timeline for d1v0ed2: