SCOPe 2.06: Domain d1v0ed2: 1v0e D:761-910

Lineage for d1v0ed2 (1v0e D:761-910)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
   (homo)trimer; each chain donates 3 beta-strands per turn of the helix

4. Superfamily b.108.1: Phage fibre proteins [69349] (6 families)

5. Family b.108.1.3: Endo-alpha-sialidase [117325] (1 protein)
   automatically mapped to Pfam PF12219

6. Protein Endo-alpha-sialidase [117326] (1 species)

7. Species Bacteriophage K1F [TaxId:344021] [117327] (2 PDB entries)
   Uniprot Q04830 245-909

8. Domain d1v0ed2: 1v0e D:761-910 [113473]
   Other proteins in same PDB: d1v0ea1, d1v0eb1, d1v0ec1, d1v0ed1, d1v0ee1, d1v0ef1
   complexed with po4

Details for d1v0ed2

PDB Entry: 1v0e, 1.9 Å

PDB Description: endosialidase of bacteriophage k1f

PDB Compounds: (D:) endo-alpha-sialidase

SCOPe Domain Sequences for d1v0ed2:

Sequence; same for both SEQRES and ATOM records:

>d1v0ed2 b.108.1.3 (D:761-910) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]}
srdfrygavpnravpvffdtngvrtvpapmeftgdlglghvtirastssnirsevlmege
ygfigksiptdnpagqriifcggegtssttgaqitlyganntdsrrivyngdehlfqsad
vkpyndnvtalggpsnrfttaylgsnpivt

Timeline for d1v0ed2:

• d1v0ed2 first appeared in SCOP 1.71
  
• d1v0ed2 appears in SCOPe 2.05
  
• d1v0ed2 appears in SCOPe 2.07
  
• d1v0ed2 appears in the current release, SCOPe 2.08