Lineage for d1v0ed2 (1v0e D:761-910)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821021Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 2821022Superfamily b.108.1: Phage fibre proteins [69349] (6 families) (S)
  5. 2821031Family b.108.1.3: Endo-alpha-sialidase [117325] (1 protein)
    automatically mapped to Pfam PF12219
  6. 2821032Protein Endo-alpha-sialidase [117326] (1 species)
  7. 2821033Species Bacteriophage K1F [TaxId:344021] [117327] (2 PDB entries)
    Uniprot Q04830 245-909
  8. 2821037Domain d1v0ed2: 1v0e D:761-910 [113473]
    Other proteins in same PDB: d1v0ea1, d1v0eb1, d1v0ec1, d1v0ed1, d1v0ee1, d1v0ef1
    complexed with po4

Details for d1v0ed2

PDB Entry: 1v0e (more details), 1.9 Å

PDB Description: endosialidase of bacteriophage k1f
PDB Compounds: (D:) endo-alpha-sialidase

SCOPe Domain Sequences for d1v0ed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0ed2 b.108.1.3 (D:761-910) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]}
srdfrygavpnravpvffdtngvrtvpapmeftgdlglghvtirastssnirsevlmege
ygfigksiptdnpagqriifcggegtssttgaqitlyganntdsrrivyngdehlfqsad
vkpyndnvtalggpsnrfttaylgsnpivt

SCOPe Domain Coordinates for d1v0ed2:

Click to download the PDB-style file with coordinates for d1v0ed2.
(The format of our PDB-style files is described here.)

Timeline for d1v0ed2: