Lineage for d1uzvd_ (1uzv D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430565Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2430566Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2430567Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. 2430568Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)
  7. 2430569Species Pseudomonas aeruginosa [TaxId:287] [82029] (12 PDB entries)
    Uniprot Q9HYN5 # PA3361
  8. 2430577Domain d1uzvd_: 1uzv D: [113464]
    complexed with ca, fuc, so4

Details for d1uzvd_

PDB Entry: 1uzv (more details), 1 Å

PDB Description: high affinity fucose binding of pseudomonas aeruginosa lectin ii: 1.0 a crystal structure of the complex
PDB Compounds: (D:) pseudomonas aeruginosa lectin II

SCOPe Domain Sequences for d1uzvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzvd_ b.115.1.1 (D:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d1uzvd_:

Click to download the PDB-style file with coordinates for d1uzvd_.
(The format of our PDB-style files is described here.)

Timeline for d1uzvd_: