SCOPe 2.06: Domain d1uzvd_: 1uzv D:

Lineage for d1uzvd_ (1uzv D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
   automatically mapped to Pfam PF07472

6. Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82029] (11 PDB entries)
   Uniprot Q9HYN5 # PA3361

8. Domain d1uzvd_: 1uzv D: [113464]
   complexed with ca, fuc, so4

Details for d1uzvd_

PDB Entry: 1uzv, 1 Å

PDB Description: high affinity fucose binding of pseudomonas aeruginosa lectin ii: 1.0 a crystal structure of the complex

PDB Compounds: (D:) pseudomonas aeruginosa lectin II

SCOPe Domain Sequences for d1uzvd_:

Sequence; same for both SEQRES and ATOM records:

>d1uzvd_ b.115.1.1 (D:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

Timeline for d1uzvd_:

• d1uzvd_ first appeared in SCOP 1.71
  
• d1uzvd_ appears in SCOPe 2.05
  
• d1uzvd_ appears in SCOPe 2.07
  
• d1uzvd_ appears in the current release, SCOPe 2.08