Lineage for d1uzvc_ (1uzv C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679513Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 679514Superfamily b.115.1: Calcium-mediated lectin [82026] (1 family) (S)
  5. 679515Family b.115.1.1: Calcium-mediated lectin [82027] (2 proteins)
  6. 679516Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)
  7. 679517Species Pseudomonas aeruginosa [TaxId:287] [82029] (12 PDB entries)
  8. 679520Domain d1uzvc_: 1uzv C: [113463]

Details for d1uzvc_

PDB Entry: 1uzv (more details), 1 Å

PDB Description: high affinity fucose binding of pseudomonas aeruginosa lectin ii: 1.0 a crystal structure of the complex
PDB Compounds: (C:) pseudomonas aeruginosa lectin II

SCOP Domain Sequences for d1uzvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzvc_ b.115.1.1 (C:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOP Domain Coordinates for d1uzvc_:

Click to download the PDB-style file with coordinates for d1uzvc_.
(The format of our PDB-style files is described here.)

Timeline for d1uzvc_: