![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
![]() | Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) ![]() |
![]() | Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins) automatically mapped to Pfam PF07472 |
![]() | Protein Fucose-binding lectin II (PA-LII) [82028] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [82029] (13 PDB entries) Uniprot Q9HYN5 # PA3361 |
![]() | Domain d1uzvc_: 1uzv C: [113463] complexed with ca, fuc, so4 |
PDB Entry: 1uzv (more details), 1 Å
SCOPe Domain Sequences for d1uzvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzvc_ b.115.1.1 (C:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]} atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
Timeline for d1uzvc_: