![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.17: Fungal lipases [53558] (5 proteins) |
![]() | Protein Feruloyl esterase A [102631] (1 species) Triacylglycerol lipase homologue |
![]() | Species Aspergillus niger [TaxId:5061] [102632] (5 PDB entries) Uniprot O42807 23-281 |
![]() | Domain d1uzab1: 1uza B:2-260 [113460] Other proteins in same PDB: d1uzaa2, d1uzab2 complexed with nag, so4 |
PDB Entry: 1uza (more details), 1.5 Å
SCOPe Domain Sequences for d1uzab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzab1 c.69.1.17 (B:2-260) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} stqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtskei itvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqasq ypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvssp ettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqggq gvndahttyfgmtsgactw
Timeline for d1uzab1: