Lineage for d1uz4a_ (1uz4 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571449Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 571701Protein Exomannosidase [102068] (1 species)
    mannosyl-oligosaccharide glucosidase
  7. 571702Species Cellvibrio mixtus [TaxId:39650] [102069] (2 PDB entries)
  8. 571704Domain d1uz4a_: 1uz4 A: [113458]
    complexed with gol, ifl, so4

Details for d1uz4a_

PDB Entry: 1uz4 (more details), 1.71 Å

PDB Description: common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis

SCOP Domain Sequences for d1uz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uz4a_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus}
ehfvrvngghfelqgkpyvitgvnmwyaaylgapnevgdrdrlakeldnlkaigvnnlrv
lavsekseinsavkpavtngfgnydetllqgldyllvelakrdmtvvlyfnnfwqwsggm
tqymawiegepvqdpnvtneweafmaksasfyrsekaqqeyrktlekiitrvnsingkay
vddatimswqlaneprpgnsqttaeekqiyidwvhaaaayiktldahhlvssgsegemgs
vndmqvfidahatpdidyltyhmwirnwswfdktkpaetwpsawekaqnymrahidvakq
lnkplvleefgldrdmgsyamdstteyrdnyfrgvfelmlasleqgepsagyniwawngy
grttranywwqegddfmgdppqeeqgmygvfdtdtstiaimkefnarfqp

SCOP Domain Coordinates for d1uz4a_:

Click to download the PDB-style file with coordinates for d1uz4a_.
(The format of our PDB-style files is described here.)

Timeline for d1uz4a_: