Lineage for d1uxwa2 (1uxw A:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600336Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (8 PDB entries)
  8. 600340Domain d1uxwa2: 1uxw A:1-181 [113454]
    Other proteins in same PDB: d1uxwa1, d1uxwb_
    complexed with gol

Details for d1uxwa2

PDB Entry: 1uxw (more details), 1.71 Å

PDB Description: crystal structure of hla-b*2709 complexed with the latent membrane protein 2 peptide (lmp2) of epstein-barr virus

SCOP Domain Sequences for d1uxwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxwa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqhaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOP Domain Coordinates for d1uxwa2:

Click to download the PDB-style file with coordinates for d1uxwa2.
(The format of our PDB-style files is described here.)

Timeline for d1uxwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uxwa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1uxwb_