Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (9 PDB entries) Uniprot P03989 25-300 |
Domain d1uxwa2: 1uxw A:1-181 [113454] Other proteins in same PDB: d1uxwa1, d1uxwb1, d1uxwb2 complexed with gol |
PDB Entry: 1uxw (more details), 1.71 Å
SCOPe Domain Sequences for d1uxwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxwa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]} gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqhaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq r
Timeline for d1uxwa2: