Lineage for d1uxwa1 (1uxw A:182-276)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548582Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 548583Species Human (Homo sapiens) [TaxId:9606] [88605] (76 PDB entries)
  8. 548590Domain d1uxwa1: 1uxw A:182-276 [113453]
    Other proteins in same PDB: d1uxwa2, d1uxwb_
    complexed with gol

Details for d1uxwa1

PDB Entry: 1uxw (more details), 1.71 Å

PDB Description: crystal structure of hla-b*2709 complexed with the latent membrane protein 2 peptide (lmp2) of epstein-barr virus

SCOP Domain Sequences for d1uxwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxwa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1uxwa1:

Click to download the PDB-style file with coordinates for d1uxwa1.
(The format of our PDB-style files is described here.)

Timeline for d1uxwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uxwa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1uxwb_