| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
| Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (9 PDB entries) Uniprot P03989 25-300 |
| Domain d1uxsa2: 1uxs A:1-181 [113451] Other proteins in same PDB: d1uxsa1, d1uxsb1, d1uxsb2 complexed with gol |
PDB Entry: 1uxs (more details), 1.55 Å
SCOPe Domain Sequences for d1uxsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxsa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r
Timeline for d1uxsa2: