Lineage for d1ux8a_ (1ux8 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530469Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
    lack the first helix (A)
  6. 530470Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 530471Species Bacillus subtilis [TaxId:1423] [116748] (1 PDB entry)
  8. 530472Domain d1ux8a_: 1ux8 A: [113449]
    complexed with cl, cyn, hem

Details for d1ux8a_

PDB Entry: 1ux8 (more details), 2.15 Å

PDB Description: x-ray structure of truncated oxygen-avid haemoglobin from bacillus subtilis

SCOP Domain Sequences for d1ux8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ux8a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Bacillus subtilis}
napyeaigeellsqlvdtfyervashpllkpifpsdltetarkqkqfltqylggpplyte
ehghpmlrarhlpfpitneradawlscmkdamdhvglegeireflfgrleltarhmvnq

SCOP Domain Coordinates for d1ux8a_:

Click to download the PDB-style file with coordinates for d1ux8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ux8a_: