Lineage for d1ux7a_ (1ux7 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384574Family b.18.1.28: Family 36 carbohydrate binding module, CBM36 [117114] (1 protein)
    automatically mapped to Pfam PF03422
  6. 2384575Protein Endo-1,4-beta-xylanase D [117115] (1 species)
  7. 2384576Species Paenibacillus polymyxa [TaxId:1406] [117116] (2 PDB entries)
    Uniprot P45796 516-635
  8. 2384578Domain d1ux7a_: 1ux7 A: [113448]
    complexed with ca, so4

Details for d1ux7a_

PDB Entry: 1ux7 (more details), 1.5 Å

PDB Description: carbohydrate-binding module cbm36 in complex with calcium and xylotriose
PDB Compounds: (A:) endo-1,4-beta-xylanase d

SCOPe Domain Sequences for d1ux7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ux7a_ b.18.1.28 (A:) Endo-1,4-beta-xylanase D {Paenibacillus polymyxa [TaxId: 1406]}
itkveaenmkiggtyagkisapfdgvalyanadyvsysqyfansthnisvrgassnagta
kvdlviggvtvgsfnftgktptvqtlsnithatgdqeiklaltsddgtwdayvdfiefsl

SCOPe Domain Coordinates for d1ux7a_:

Click to download the PDB-style file with coordinates for d1ux7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ux7a_: