![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.28: Family 36 carbohydrate binding module, CBM36 [117114] (1 protein) automatically mapped to Pfam PF03422 |
![]() | Protein Endo-1,4-beta-xylanase D [117115] (1 species) |
![]() | Species Paenibacillus polymyxa [TaxId:1406] [117116] (2 PDB entries) Uniprot P45796 516-635 |
![]() | Domain d1ux7a_: 1ux7 A: [113448] complexed with ca, so4 |
PDB Entry: 1ux7 (more details), 1.5 Å
SCOPe Domain Sequences for d1ux7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ux7a_ b.18.1.28 (A:) Endo-1,4-beta-xylanase D {Paenibacillus polymyxa [TaxId: 1406]} itkveaenmkiggtyagkisapfdgvalyanadyvsysqyfansthnisvrgassnagta kvdlviggvtvgsfnftgktptvqtlsnithatgdqeiklaltsddgtwdayvdfiefsl
Timeline for d1ux7a_: