![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) ![]() similar putative active site with a conserved cysteine residue |
![]() | Family d.52.8.2: PaaD-like [117922] (3 proteins) Pfam PF01883; DUF59 |
![]() | Protein Hypothetical protein TM0487 [117923] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [117924] (2 PDB entries) Uniprot Q9WYV7 |
![]() | Domain d1uwda_: 1uwd A: [113447] Structural genomics target |
PDB Entry: 1uwd (more details)
SCOPe Domain Sequences for d1uwda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} mskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagmi lsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv
Timeline for d1uwda_: