SCOPe 2.06: Domain d1uvcb_: 1uvc B:

Lineage for d1uvcb_ (1uvc B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)

6. Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [47707] (5 PDB entries)
   Uniprot P23096 26-116

8. Domain d1uvcb_: 1uvc B: [113446]
   complexed with ste

Details for d1uvcb_

PDB Entry: 1uvc, 2 Å

PDB Description: lipid binding in rice nonspecific lipid transfer protein-1 complexes from oryza sativa

PDB Compounds: (B:) nonspecific lipid transfer protein

SCOPe Domain Sequences for d1uvcb_:

Sequence; same for both SEQRES and ATOM records:

>d1uvcb_ a.52.1.1 (B:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Rice (Oryza sativa) [TaxId: 4530]}
itcgqvnsavgpcltyarggagpsaaccsgvrslkaaasttadrrtacnclknaargikg
lnagnaasipskcgvsvpytisasidcsrvs

Timeline for d1uvcb_:

• d1uvcb_ first appeared in SCOP 1.71
  
• d1uvcb_ appears in SCOPe 2.05
  
• d1uvcb_ appears in SCOPe 2.07
  
• d1uvcb_ appears in the current release, SCOPe 2.08