Lineage for d1uvba_ (1uvb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328002Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2328003Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2328004Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)
  6. 2328012Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)
  7. 2328034Species Rice (Oryza sativa) [TaxId:4530] [47707] (5 PDB entries)
    Uniprot P23096 26-116
  8. 2328038Domain d1uvba_: 1uvb A: [113444]
    complexed with pam

Details for d1uvba_

PDB Entry: 1uvb (more details), 2.1 Å

PDB Description: lipid binding in rice nonspecific lipid transfer protein-1 complexes from oryza sativa
PDB Compounds: (A:) nonspecific lipid transfer protein

SCOPe Domain Sequences for d1uvba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvba_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Rice (Oryza sativa) [TaxId: 4530]}
itcgqvnsavgpcltyarggagpsaaccsgvrslkaaasttadrrtacnclknaargikg
lnagnaasipskcgvsvpytisasidcsrvs

SCOPe Domain Coordinates for d1uvba_:

Click to download the PDB-style file with coordinates for d1uvba_.
(The format of our PDB-style files is described here.)

Timeline for d1uvba_: