Lineage for d1uvba_ (1uvb A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539027Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 539028Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (3 families) (S)
    can be classified as disulfide-rich
  5. 539029Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (3 proteins)
  6. 539035Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)
  7. 539053Species Rice (Oryza sativa) [TaxId:4530] [47707] (5 PDB entries)
  8. 539057Domain d1uvba_: 1uvb A: [113444]
    complexed with pam

Details for d1uvba_

PDB Entry: 1uvb (more details), 2.1 Å

PDB Description: lipid binding in rice nonspecific lipid transfer protein-1 complexes from oryza sativa

SCOP Domain Sequences for d1uvba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvba_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Rice (Oryza sativa)}
itcgqvnsavgpcltyarggagpsaaccsgvrslkaaasttadrrtacnclknaargikg
lnagnaasipskcgvsvpytisasidcsrvs

SCOP Domain Coordinates for d1uvba_:

Click to download the PDB-style file with coordinates for d1uvba_.
(The format of our PDB-style files is described here.)

Timeline for d1uvba_: