SCOP 1.73: Domain d1utzb_: 1utz B:

Lineage for d1utzb_ (1utz B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (15 PDB entries)

8. Domain d1utzb_: 1utz B: [113432]
   complexed with ca, hae, pf3, zn

Details for d1utzb_

PDB Entry: 1utz, 2.5 Å

PDB Description: crystal structure of mmp-12 complexed to (2r)-3-({[4-[(pyridin-4-yl) phenyl]-thien-2-yl}carboxamido)(phenyl)propanoic acid

PDB Compounds: (B:) Macrophage metalloelastase

SCOP Domain Sequences for d1utzb_:

Sequence; same for both SEQRES and ATOM records:

>d1utzb_ d.92.1.11 (B:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygd

Timeline for d1utzb_:

• d1utzb_ first appeared in SCOP 1.71
  
• d1utzb_ appears in SCOP 1.75
  
• d1utzb_ appears in the current release, SCOPe 2.08