Lineage for d1utza_ (1utz A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729341Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 729421Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 729422Species Human (Homo sapiens) [TaxId:9606] [69781] (15 PDB entries)
  8. 729447Domain d1utza_: 1utz A: [113431]

Details for d1utza_

PDB Entry: 1utz (more details), 2.5 Å

PDB Description: crystal structure of mmp-12 complexed to (2r)-3-({[4-[(pyridin-4-yl) phenyl]-thien-2-yl}carboxamido)(phenyl)propanoic acid
PDB Compounds: (A:) Macrophage metalloelastase

SCOP Domain Sequences for d1utza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utza_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygd

SCOP Domain Coordinates for d1utza_:

Click to download the PDB-style file with coordinates for d1utza_.
(The format of our PDB-style files is described here.)

Timeline for d1utza_: