Lineage for d1utza_ (1utz A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) Protein Macrophage elastase (MMP-12) [69780] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
Uniprot P39900 106-263 ! Uniprot P39900 106-264
Domain d1utza_: 1utz A: [113431]
complexed with ca, hae, pf3, zn
Details for d1utza_
PDB Entry: 1utz (more details), 2.5 Å
PDB Description: crystal structure of mmp-12 complexed to (2r)-3-({[4-[(pyridin-4-yl) phenyl]-thien-2-yl}carboxamido)(phenyl)propanoic acid
PDB Compounds: (A:) Macrophage metalloelastaseSCOPe Domain Sequences for d1utza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utza_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygd
SCOPe Domain Coordinates for d1utza_:
Click to download the PDB-style file with coordinates for d1utza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1utza_:
- d1utza_ first appeared in SCOP 1.71
- d1utza_ appears in SCOPe 2.07
View in 3D
