Lineage for d1usyh_ (1usy H:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846214Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species)
    there is an additional C-terminal allosteric domain in some species
  7. 846230Species Thermotoga maritima [TaxId:2336] [102699] (3 PDB entries)
    Uniprot Q9X0D2
  8. 846238Domain d1usyh_: 1usy H: [113429]
    Other proteins in same PDB: d1usya_, d1usyb_, d1usyc_, d1usyd_
    complexed with his, po4

Details for d1usyh_

PDB Entry: 1usy (more details), 2.52 Å

PDB Description: ATP phosphoribosyl transferase (HisG:HisZ) complex from Thermotoga maritima
PDB Compounds: (H:) ATP phosphoribosyltransferase

SCOP Domain Sequences for d1usyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usyh_ c.94.1.1 (H:) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermotoga maritima [TaxId: 2336]}
mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi
gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk
gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy
rtkrekvvsfleklqeviehds

SCOP Domain Coordinates for d1usyh_:

Click to download the PDB-style file with coordinates for d1usyh_.
(The format of our PDB-style files is described here.)

Timeline for d1usyh_: