SCOP 1.71: Domain d1usyg_: 1usy G:

Lineage for d1usyg_ (1usy G:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (29 proteins)

6. Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (3 species)
   there is an additional C-terminal allosteric domain in some species

7. Species Thermotoga maritima [TaxId:243274] [102699] (3 PDB entries)

8. Domain d1usyg_: 1usy G: [113428]
   Other proteins in same PDB: d1usya_, d1usyb_, d1usyc_, d1usyd_

Details for d1usyg_

PDB Entry: 1usy, 2.52 Å

PDB Description: ATP phosphoribosyl transferase (HisG:HisZ) complex from Thermotoga maritima

SCOP Domain Sequences for d1usyg_:

Sequence; same for both SEQRES and ATOM records:

>d1usyg_ c.94.1.1 (G:) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermotoga maritima}
mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi
gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk
gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy
rtkreevvsfleklqeviehdsne

Timeline for d1usyg_:

• d1usyg_ is new in SCOP 1.71
  
• d1usyg_ appears in SCOP 1.73
  
• d1usyg_ appears in the current release, SCOPe 2.08