Lineage for d1usyd_ (1usy D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. Protein ATP phosphoribosyltransferase regulatory subunit HisZ [118058] (2 species)
    shares histidine-binding site with the HisRS catalytic domain
  7. Species Thermotoga maritima [TaxId:2336] [118059] (1 PDB entry)
    Uniprot Q9X0D3
  8. Domain d1usyd_: 1usy D: [113425]
    Other proteins in same PDB: d1usye_, d1usyf_, d1usyg_, d1usyh_
    protein/RNA complex; complexed with his, po4

Details for d1usyd_

PDB Entry: 1usy (more details), 2.52 Å

PDB Description: ATP phosphoribosyl transferase (HisG:HisZ) complex from Thermotoga maritima
PDB Compounds: (D:) ATP phosphoribosyltransferase regulatory subunit

SCOPe Domain Sequences for d1usyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usyd_ d.104.1.1 (D:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]}
dfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvlnh
rkryspdsqikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesaseff
egpviveightgvyedllkeipkdlhekvlnlidtknlaeieflshmkkidlsrvekiie
dsiyrrspehlktmdlplsvredllsassflqekfptvsveidltlartieeycglifti
ydtsssrlvaaggeytvngekgvggsiflegktc

SCOPe Domain Coordinates for d1usyd_ are not available.

Timeline for d1usyd_:

Domains from other chains:
(mouse over for more information)
d1usya_, d1usyb_, d1usyc_, d1usye_, d1usyf_, d1usyg_, d1usyh_