![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins) |
![]() | Protein ATP phosphoribosyltransferase regulatory subunit HisZ [118058] (2 species) shares histidine-binding site with the HisRS catalytic domain |
![]() | Species Thermotoga maritima [TaxId:2336] [118059] (1 PDB entry) |
![]() | Domain d1usyb_: 1usy B: [113423] Other proteins in same PDB: d1usye_, d1usyf_, d1usyg_, d1usyh_ |
PDB Entry: 1usy (more details), 2.52 Å
SCOP Domain Sequences for d1usyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1usyb_ d.104.1.1 (B:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} mdfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvln hrkryspdsqikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesasef fegpviveightgvyedllkeipkdlhekvlnlidtknlaeieflshmkkidlsrvekii edsiyrrspehlktmdlplsvredllsassflqekfptvsveidltlartieeycglift iydtsssrlvaaggeytvngekgvggsiflegktc
Timeline for d1usyb_: