Lineage for d1usya_ (1usy A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869604Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 869605Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 869606Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)
  6. 869649Protein ATP phosphoribosyltransferase regulatory subunit HisZ [118058] (2 species)
    shares histidine-binding site with the HisRS catalytic domain
  7. 869659Species Thermotoga maritima [TaxId:2336] [118059] (1 PDB entry)
    Uniprot Q9X0D3
  8. 869660Domain d1usya_: 1usy A: [113422]
    Other proteins in same PDB: d1usye_, d1usyf_, d1usyg_, d1usyh_

Details for d1usya_

PDB Entry: 1usy (more details), 2.52 Å

PDB Description: ATP phosphoribosyl transferase (HisG:HisZ) complex from Thermotoga maritima
PDB Compounds: (A:) ATP phosphoribosyltransferase regulatory subunit

SCOP Domain Sequences for d1usya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]}
mdfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvln
hrkryspdsqikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesasef
fegpviveightgvyedllkeipkdlhekvlnlidtknlaeieflshmkkidlsrvekii
edsiyrrspehlktmdlplsvredllsassflqekfptvsveidltlartieeycglift
iydtsssrlvaaggeytvngekgvggsiflegktc

SCOP Domain Coordinates for d1usya_:

Click to download the PDB-style file with coordinates for d1usya_.
(The format of our PDB-style files is described here.)

Timeline for d1usya_: