Lineage for d1usya_ (1usy A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967618Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2967662Protein ATP phosphoribosyltransferase regulatory subunit HisZ [118058] (2 species)
    shares histidine-binding site with the HisRS catalytic domain
  7. 2967672Species Thermotoga maritima [TaxId:2336] [118059] (1 PDB entry)
    Uniprot Q9X0D3
  8. 2967673Domain d1usya_: 1usy A: [113422]
    Other proteins in same PDB: d1usye_, d1usyf_, d1usyg_, d1usyh_
    protein/RNA complex; complexed with his, po4
    has additional subdomain(s) that are not in the common domain

Details for d1usya_

PDB Entry: 1usy (more details), 2.52 Å

PDB Description: ATP phosphoribosyl transferase (HisG:HisZ) complex from Thermotoga maritima
PDB Compounds: (A:) ATP phosphoribosyltransferase regulatory subunit

SCOPe Domain Sequences for d1usya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]}
mdfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvln
hrkryspdsqikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesasef
fegpviveightgvyedllkeipkdlhekvlnlidtknlaeieflshmkkidlsrvekii
edsiyrrspehlktmdlplsvredllsassflqekfptvsveidltlartieeycglift
iydtsssrlvaaggeytvngekgvggsiflegktc

SCOPe Domain Coordinates for d1usya_:

Click to download the PDB-style file with coordinates for d1usya_.
(The format of our PDB-style files is described here.)

Timeline for d1usya_: