Lineage for d1usda_ (1usd A:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2645196Superfamily h.1.29: Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain [118370] (1 family) (S)
    tetrameric parallel coiled coil with a right-handed twist
  5. 2645197Family h.1.29.1: Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain [118371] (1 protein)
  6. 2645198Protein Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain [118372] (1 species)
  7. 2645199Species Human (Homo sapiens) [TaxId:9606] [118373] (2 PDB entries)
    Uniprot P50552 337-378 # structure of the N-terminal, EVH1 domain (1-114) is also known (50773)
  8. 2645201Domain d1usda_: 1usd A: [113418]

Details for d1usda_

PDB Entry: 1usd (more details), 1.7 Å

PDB Description: human vasp tetramerisation domain l352m
PDB Compounds: (A:) vasodilator-stimulated phosphoprotein

SCOPe Domain Sequences for d1usda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usda_ h.1.29.1 (A:) Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain {Human (Homo sapiens) [TaxId: 9606]}
ssdysdlqrvkqelmeevkkelqkvkeeiieafvqelrkrgs

SCOPe Domain Coordinates for d1usda_:

Click to download the PDB-style file with coordinates for d1usda_.
(The format of our PDB-style files is described here.)

Timeline for d1usda_: