Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Cytoglobin [109626] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [109627] (8 PDB entries) Uniprot Q8WWM9 18-171 |
Domain d1uryb_: 1ury B: [113417] complexed with fc6, hem, xe |
PDB Entry: 1ury (more details), 2.4 Å
SCOPe Domain Sequences for d1uryb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uryb_ a.1.1.2 (B:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]} elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae efasdfppetqrawaklrgliyshvtaaykevgw
Timeline for d1uryb_: