Lineage for d1urya_ (1ury A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631711Protein Cytoglobin [109626] (1 species)
  7. 631712Species Human (Homo sapiens) [TaxId:9606] [109627] (6 PDB entries)
  8. 631719Domain d1urya_: 1ury A: [113416]

Details for d1urya_

PDB Entry: 1ury (more details), 2.4 Å

PDB Description: cytoglobin cavities
PDB Compounds: (A:) cytoglobin

SCOP Domain Sequences for d1urya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urya_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw

SCOP Domain Coordinates for d1urya_:

Click to download the PDB-style file with coordinates for d1urya_.
(The format of our PDB-style files is described here.)

Timeline for d1urya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uryb_