| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
| Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
| Protein Cytoglobin [109626] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [109627] (6 PDB entries) |
| Domain d1urvb_: 1urv B: [113415] complexed with fc6, hem; mutant |
PDB Entry: 1urv (more details), 2 Å
SCOP Domain Sequences for d1urvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urvb_ a.1.1.2 (B:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw
Timeline for d1urvb_: