Lineage for d1urvb_ (1urv B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1976512Protein Cytoglobin [109626] (1 species)
  7. 1976513Species Human (Homo sapiens) [TaxId:9606] [109627] (8 PDB entries)
    Uniprot Q8WWM9 18-171
  8. 1976517Domain d1urvb_: 1urv B: [113415]
    complexed with fc6, hem

Details for d1urvb_

PDB Entry: 1urv (more details), 2 Å

PDB Description: crystal structure of cytoglobin: the fourth globin type discovered in man displays heme hexa-coordination
PDB Compounds: (B:) cytoglobin

SCOPe Domain Sequences for d1urvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urvb_ a.1.1.2 (B:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw

SCOPe Domain Coordinates for d1urvb_:

Click to download the PDB-style file with coordinates for d1urvb_.
(The format of our PDB-style files is described here.)

Timeline for d1urvb_: