SCOPe 2.08: Domain d1urma1: 1urm A:1-161

Lineage for d1urma1 (1urm A:1-161)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Peroxiredoxin 5 [64066] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64067] (4 PDB entries)
   Uniprot P30044

8. Domain d1urma1: 1urm A:1-161 [113413]
   Other proteins in same PDB: d1urma2
   complexed with bez, cl; mutant

Details for d1urma1

PDB Entry: 1urm, 1.7 Å

PDB Description: human peroxiredoxin 5, c47s mutant

PDB Compounds: (A:) peroxiredoxin 5

SCOPe Domain Sequences for d1urma1:

Sequence; same for both SEQRES and ATOM records:

>d1urma1 c.47.1.10 (A:1-161) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]}
apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgsskthlpgfveqae
alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif
gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

Timeline for d1urma1:

• d1urma1 first appeared in SCOP 1.71, called d1urma_
  
• d1urma1 appears in SCOPe 2.07