Lineage for d1urla_ (1url A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741827Protein N-terminal domain of sialoadhesin [48732] (1 species)
  7. 2741828Species Mouse (Mus musculus) [TaxId:10090] [48733] (6 PDB entries)
    Uniprot Q62230 20-130
  8. 2741834Domain d1urla_: 1url A: [113412]
    complexed with sia

Details for d1urla_

PDB Entry: 1url (more details), 2.4 Å

PDB Description: n-terminal domain of sialoadhesin (mouse) in complex with glycopeptide
PDB Compounds: (A:) sialoadhesin

SCOPe Domain Sequences for d1urla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urla_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvtt

SCOPe Domain Coordinates for d1urla_:

Click to download the PDB-style file with coordinates for d1urla_.
(The format of our PDB-style files is described here.)

Timeline for d1urla_: