Lineage for d1urcd2 (1urc D:310-432)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000824Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2000825Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2000826Family a.74.1.1: Cyclin [47955] (9 protein domains)
  6. 2000839Protein Cyclin A [47956] (2 species)
  7. 2000875Species Human (Homo sapiens) [TaxId:9606] [47957] (78 PDB entries)
    Uniprot P20248 175-432
  8. 2001053Domain d1urcd2: 1urc D:310-432 [113409]
    Other proteins in same PDB: d1urca_, d1urcc_

Details for d1urcd2

PDB Entry: 1urc (more details), 2.6 Å

PDB Description: Cyclin A binding groove inhibitor Ace-Arg-Lys-Leu-Phe-Gly
PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d1urcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urcd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d1urcd2:

Click to download the PDB-style file with coordinates for d1urcd2.
(The format of our PDB-style files is described here.)

Timeline for d1urcd2: