SCOPe 2.02: Domain d1urcb1: 1urc B:175-309

Lineage for d1urcb1 (1urc B:175-309)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (52 PDB entries)
   Uniprot P20248 175-432

8. Domain d1urcb1: 1urc B:175-309 [113405]
   Other proteins in same PDB: d1urca_, d1urcc_

Details for d1urcb1

PDB Entry: 1urc, 2.6 Å

PDB Description: cyclin a binding groove inhibitor ace-arg-lys-leu-phe-gly

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1urcb1:

Sequence; same for both SEQRES and ATOM records:

>d1urcb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d1urcb1:

• d1urcb1 first appeared in SCOP 1.71
  
• d1urcb1 appears in SCOPe 2.01
  
• d1urcb1 appears in SCOPe 2.03
  
• d1urcb1 appears in the current release, SCOPe 2.08