Lineage for d1ur4b_ (1ur4 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571449Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 571464Protein Beta-1,4-galactanase [89469] (4 species)
  7. 571465Species Bacillus licheniformis [TaxId:1402] [117367] (3 PDB entries)
  8. 571467Domain d1ur4b_: 1ur4 B: [113403]
    complexed with b2g, ca, peg, pig

Details for d1ur4b_

PDB Entry: 1ur4 (more details), 2.2 Å

PDB Description: the structure of endo-beta-1,4-galactanase from bacillus licheniformis in complex with two oligosaccharide products.

SCOP Domain Sequences for d1ur4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur4b_ c.1.8.3 (B:) Beta-1,4-galactanase {Bacillus licheniformis}
glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
nqalfdfkgrplpslhvfqyvdtgtpfk

SCOP Domain Coordinates for d1ur4b_:

Click to download the PDB-style file with coordinates for d1ur4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ur4b_: