Lineage for d1ur0a_ (1ur0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830587Protein Beta-1,4-galactanase [89469] (4 species)
  7. 2830588Species Bacillus licheniformis [TaxId:1402] [117367] (4 PDB entries)
    Uniprot Q65CX5 36-422 ! Uniprot Q65CX5 28-424
  8. 2830594Domain d1ur0a_: 1ur0 A: [113400]
    complexed with ca, pge

Details for d1ur0a_

PDB Entry: 1ur0 (more details), 2.5 Å

PDB Description: the structure of endo-beta-1,4-galactanase from bacillus licheniformis in complex with two oligosaccharide products.
PDB Compounds: (A:) galactanase

SCOPe Domain Sequences for d1ur0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur0a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]}
glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
nqalfdfkgrplpslhvfqyvdtgtpf

SCOPe Domain Coordinates for d1ur0a_:

Click to download the PDB-style file with coordinates for d1ur0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ur0a_: