Lineage for d1upva_ (1upv A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Oxysterols receptor LXR-beta [89149] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [89150] (21 PDB entries)
    Uniprot P55055 219-461
  8. Domain d1upva_: 1upv A: [113398]
    complexed with 444

Details for d1upva_

PDB Entry: 1upv (more details), 2.1 Å

PDB Description: crystal structure of the human liver x receptor beta ligand binding domain in complex with a synthetic agonist
PDB Compounds: (A:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d1upva_:

Sequence, based on SEQRES records: (download)

>d1upva_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrfahftelaiis
vqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskd
dfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqp
yveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
vhe

Sequence, based on observed residues (ATOM records): (download)

>d1upva_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqvtpwplgadpqsrdarqqrfahftelaiisvqeivdfakqv
pgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglqvef
inpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsytri
krpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdvhe

SCOPe Domain Coordinates for d1upva_ are not available.

Timeline for d1upva_: