Lineage for d1upqa_ (1upq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803211Protein Phosphoinositol 3-phosphate binding protein-1, PEPP1 [117244] (1 species)
  7. 2803212Species Human (Homo sapiens) [TaxId:9606] [117245] (2 PDB entries)
    Uniprot Q9H4M7 47-153
  8. 2803213Domain d1upqa_: 1upq A: [113392]
    complexed with so4

Details for d1upqa_

PDB Entry: 1upq (more details), 1.48 Å

PDB Description: crystal structure of the pleckstrin homology (ph) domain of pepp1
PDB Compounds: (A:) pepp1

SCOPe Domain Sequences for d1upqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]}
lrrdpnlpvhirgwlhkqdssglrlwkrrwfvlsghclfyykdsreesvlgsvllpsyni
rpdgpgaprgrrftftaehpgmrtyvlaadtledlrgwlralgrasr

SCOPe Domain Coordinates for d1upqa_:

Click to download the PDB-style file with coordinates for d1upqa_.
(The format of our PDB-style files is described here.)

Timeline for d1upqa_: