SCOPe 2.05: Domain d1upda_: 1upd A:

Lineage for d1upda_ (1upd A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (10 PDB entries)
   Uniprot Q9L915

8. Domain d1upda_: 1upd A: [113391]
   complexed with hec

Details for d1upda_

PDB Entry: 1upd, 1.4 Å

PDB Description: oxidized structure of cytochrome c3 from desulfovibrio desulfuricans atcc 27774 at ph 7.6

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d1upda_:

Sequence; same for both SEQRES and ATOM records:

>d1upda_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}
apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp

Timeline for d1upda_:

• d1upda_ first appeared in SCOP 1.71
  
• d1upda_ appears in SCOPe 2.04
  
• d1upda_ appears in SCOPe 2.06
  
• d1upda_ appears in the current release, SCOPe 2.08