Lineage for d1upda_ (1upd A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544896Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 544897Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 544898Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins)
  6. 544906Protein Cytochrome c3 [48697] (7 species)
    contains four heme groups
  7. 544914Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (8 PDB entries)
  8. 544916Domain d1upda_: 1upd A: [113391]
    complexed with hec

Details for d1upda_

PDB Entry: 1upd (more details), 1.4 Å

PDB Description: oxidized structure of cytochrome c3 from desulfovibrio desulfuricans atcc 27774 at ph 7.6

SCOP Domain Sequences for d1upda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upda_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains}
apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp

SCOP Domain Coordinates for d1upda_:

Click to download the PDB-style file with coordinates for d1upda_.
(The format of our PDB-style files is described here.)

Timeline for d1upda_: