Lineage for d1up9a_ (1up9 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347197Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2347198Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2347199Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2347208Protein Cytochrome c3 [48697] (7 species)
    contains four heme groups
  7. 2347216Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (10 PDB entries)
    Uniprot Q9L915
  8. 2347217Domain d1up9a_: 1up9 A: [113390]
    complexed with hec, so4

Details for d1up9a_

PDB Entry: 1up9 (more details), 1.35 Å

PDB Description: reduced structure of cytochrome c3 from desulfovibrio desulfuricans atcc 27774 at ph 7.6
PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d1up9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1up9a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}
apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp

SCOPe Domain Coordinates for d1up9a_:

Click to download the PDB-style file with coordinates for d1up9a_.
(The format of our PDB-style files is described here.)

Timeline for d1up9a_: