| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
| Protein Cytochrome c3 [48697] (7 species) contains four heme groups |
| Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (10 PDB entries) Uniprot Q9L915 |
| Domain d1up9a_: 1up9 A: [113390] complexed with hec, so4 |
PDB Entry: 1up9 (more details), 1.35 Å
SCOPe Domain Sequences for d1up9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1up9a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}
apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp
Timeline for d1up9a_: