Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins) family 4 glycosyl hydrolase automatically mapped to Pfam PF11975 |
Protein 6-phospho-beta-glucosidase [111254] (2 species) |
Species Thermotoga maritima [TaxId:2336] [111256] (3 PDB entries) Uniprot Q9X108 |
Domain d1up7f2: 1up7 F:163-415 [113385] Other proteins in same PDB: d1up7a1, d1up7b1, d1up7c1, d1up7d1, d1up7e1, d1up7f1, d1up7g1, d1up7h1 complexed with g6p, nad, so4 |
PDB Entry: 1up7 (more details), 2.4 Å
SCOPe Domain Sequences for d1up7f2:
Sequence, based on SEQRES records: (download)
>d1up7f2 d.162.1.2 (F:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnip dedfptwfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtavei peeltkrggsmystaaahlirdletdegkihivntrnngsienlpddyvleipcyvrsgr vhtlsqgkgdhfalsfihavkmyerltieaylkrskklalkallshplgpdvedakdlle eileanreyvklg
>d1up7f2 d.162.1.2 (F:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlklkpdedf ptwfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeel tkrggsmystaaahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtl sqgkgdhfalsfihavkmyerltieaylkrskklalkallshplgpdvedakdlleeile anreyvklg
Timeline for d1up7f2: