SCOPe 2.05: Domain d1up7d1: 1up7 D:1-162

Lineage for d1up7d1 (1up7 D:1-162)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein 6-phospho-beta-glucosidase [110428] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [110430] (3 PDB entries)
   Uniprot Q9X108

8. Domain d1up7d1: 1up7 D:1-162 [113380]
   Other proteins in same PDB: d1up7a2, d1up7b2, d1up7c2, d1up7d2, d1up7e2, d1up7f2, d1up7g2, d1up7h2
   complexed with g6p, nad, so4

Details for d1up7d1

PDB Entry: 1up7, 2.4 Å

PDB Description: structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.4 angstrom resolution in the tetragonal form with nad and glucose-6-phosphate

PDB Compounds: (D:) 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d1up7d1:

Sequence; same for both SEQRES and ATOM records:

>d1up7d1 c.2.1.5 (D:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]}
mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglc

Timeline for d1up7d1:

• d1up7d1 first appeared in SCOP 1.71
  
• d1up7d1 appears in SCOPe 2.04
  
• d1up7d1 appears in SCOPe 2.06
  
• d1up7d1 appears in the current release, SCOPe 2.08